PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070832.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family G2-like
Protein Properties Length: 393aa    MW: 42983.7 Da    PI: 8.7847
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070832.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32222277156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_011070832.1 222 KARRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 277
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.468219279IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-28219280IPR009057Homeodomain-like
SuperFamilySSF466891.94E-18220280IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-27222277IPR006447Myb domain, plants
PfamPF002497.8E-8224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MLINSHNHTD FSHKMQRCQD YIHALEEERR KIQVFQRELP LCLELVTQAI EACKQQLSGT  60
SSEYNLHGQS ECSEQTSSDV PVFEEFIPIK RASSQSDGEE QESSKKPKND SDVSNKDGKN  120
CYDKNSQKSD WLRSVQLWNQ TSDPPPKEHS PRKVAVMEVK RNGSGGAFHP FKKEKSVATT  180
APSQGPAVNK SVPPASTSSA DTGGNSGGGN KKEEKEGQSQ RKARRCWSPE LHRRFLQALQ  240
QLGGSHVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPSVPNTTA TTQPPQFVVV  300
GGIWVPPEYA SMATTATSGE ACASGVATSN VGIYAPVASL PPPFRESSAS PKQRLNSKPM  360
HSDDRGSHSE CRGQSHSPAT SSSTHTTTAS PAC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.10.0PREDICTED: uncharacterized protein LOC105156412
TrEMBLA0A068TX101e-154A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-100G2-like family protein